<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 LPV+NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       E6K, K11T, V35T, K64KR, D121H, K122E, I135T, I142V, S162Y, F171Y, K173S, D177E, V179I, T200A, I202V, Q207DN, R211K, F214L, V245Q, T286A, E291D, I293V, P294T, E312D, I326V  
>LN5329| codons 1-335
PISPIKTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPYRSQNPEIII
YQYVDDLYVGSDLEIGQHRAKVEELRNHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKDPVHGVYYDPSKDLVAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13IMV, G17E, K20I, P39AS, L63T, I64L, H69K, L89M M36I_V
>LN5329| codons 1-99
PQITLWQRPLVTVKIGEQLIEALLDTGADDTVLEEINLSGRWKPKMIGGIGGFIKVRQYD
QITLEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Rawizza, HE Accumulation of protease mutations among patients failing second-line antiretroviral therapy and response to salvage therapy in Nigeria. PLoS ONE, 2013