<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 LPV+NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V, T215F D67G, K219Q Y188L   K20R, V35T, K46Q, S68G, S105T, K122E, D123NS, I135V, S163T, K173T, Q174K, D177E, I178M, T200A, Q207D, R211K, H221Y, E224D, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293IV, G333D, Q334N  
>PJ1681| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGQISKIGPENPYNTPV
FAIKKKGGTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKTVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSTMTKILEPFRTKNPEMVI
YQYVDDLLVGSDLEIGQHRAKIEELRDHLLKWGFFTPDQKYQKDPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQDNG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47A   L10I, I13V, I15V, K20I, E35Q, M36I, R41RK, K45KR, R57K, L63P, C67E, H69K, A71AV, V82I, L89I  
>PJ1681| codons 1-99
PQITLWQRPIVTVKVGGQLIEALLDTGADDTILEQINLPGKWKPRMAGGIGGFIKVKQYD
QIPIEIEGKKVIGTVLVGPTPINIIGRNILTQIGCTLNF

References
Author Title Citation
Rawizza, HE Accumulation of protease mutations among patients failing second-line antiretroviral therapy and response to salvage therapy in Nigeria. PLoS ONE, 2013