<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 LPV+NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, T69~ K219R K103NS, Y181C, G190A   K20R, V35T, V60I, S68G, V90I, D121H, K122E, K173T, Q174K, D177E, E194EK, G196GR, T200E, I202V, Q207E, H221Y, V245Q, E248D, D250E, A272P, E291D, V292I, I293V, D324E K46M, I63L
>LM4439| codons 1-333
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGMISKIGPENPYNTPI
FALKRKDG~KWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKSKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
CQYMDDLYVASDLKIRQHREKVEELREHLLRWGFTTPDRKYQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, V82S V11I, L24I, F53L L10I, I13V, K14R, I15V, G16A, K20I, E35Q, M36I, N37D, R41K, K55R, R57K, L63P, C67E, H69K, A71V, L89I, T91S  
>LM4439| codons 1-99
PQITLWQRPIITVRVAGQLIEALIDTGADDTVLEQIDLPGKWKPKIVGGIGGLVRVKQYD
QIPIEIEGKKVIGTVLVGPTPSNIIGRNILSQIGCTLNF

References
Author Title Citation
Rawizza, HE Accumulation of protease mutations among patients failing second-line antiretroviral therapy and response to salvage therapy in Nigeria. PLoS ONE, 2013