<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, L210W, T215F K219Q K101E, G190A A98G K20R, E28K, K32Q, V35T, T39E, T69N, I94L, K103R, K122E, D123N, S162SN, K173S, Q174K, D177E, T200A, Q207A, R211N, D218E, V245Q, E248D, D250E, S251D, R284K, T286A, E291D, V292I, I293V, P294T, E312N  
>JFP103_0| codons 1-313
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIQALTEICEELEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKIVDFRELNKRTQDFWEVQLGLPHPGGLEKRKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRSKNPEIVI
YQYVDDLYVASDLEIGQHRAKIEELRAHLWNWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKEDWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKALTDIVTLTEEAE
LELAENREILKNP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G16E, E35D, M36I, R41K, R57K, L63H, H69K, K70R, L89M L10A
>JFP103_0| codons 1-99
PQITLWQRPAVTVRIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIHIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Sigaloff, KC Short communication: high rates of thymidine analogue mutations and dual-class resistance among HIV-infected Ugandan children failing first-line antiretroviral therapy. ARHR, 2013