<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q K103N A98G, P225H V35T, E40D, V60I, T69S, K122E, D123N, I135L, D177E, T200I, Q207E, R211K, L228H, V245K, D250E, A272S, L282C, L283I, T286A, I293V  
>JFP058_0| codons 1-307
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPI
FAIKKKNSSRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLLKWGFTTPDQKHQKEHPFHWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYSGIKVKQLCKCIRGAKALTEVVPLTEEAE
LELAENR

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, K20R, M36I, P39S, D60E, I62V, L63P, I64V, I72V  
>JFP058_0| codons 1-99
PQITLWQRPLVTVKIEGQLREALLDTGADDTVLEEINLSGRWKPKMIGGIGGFIKVRQYE
QVPVEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Sigaloff, KC Short communication: high rates of thymidine analogue mutations and dual-class resistance among HIV-infected Ugandan children failing first-line antiretroviral therapy. ARHR, 2013