<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MBA094_0 MBA094_0 Uganda 2010 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, L210W, T215Y K219E K103N   V35T, E40D, K49R, V60I, D123E, Q174K, D177E, Q207E, R211K, P243PS, V245K, A272P, K277R, L282C, L283I, T286A, A288T, I293V, E297A  
>MBA094_0| codons 1-316
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQSIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCIRGAKTLTEVVPLTAEAE
LELAENREILKEPVHG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36I, N37D, L63T, I64V, E65D, K70R, I72V  
>MBA094_0| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYD
QITVDICGHRAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Sigaloff, KC Short communication: high rates of thymidine analogue mutations and dual-class resistance among HIV-infected Ugandan children failing first-line antiretroviral therapy. ARHR, 2013