<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115F   Y181C   P4T, E28K, V35T, E40ED, V60I, V118I, I135T, I142V, A158S, K173E, D177E, Q207E, R211K, F214L, V245E, D250E, A272S, K275R, L282C, I293V R72K, P243K
>JCR099_0| codons 1-307
PISTIETVPVKLKPGMDGPKVKQWPLTKEKIKALTEICTDMEKEGKISKIGPENPYNTPI
FAIKRKDSTKWKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFFSIPL
DKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFREQNPEIVI
CQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQKIELPEKESWTVNDIQKLVGKLNWASQIYSGIRVKQLCKCLRGTKALTEVVPLTEEAE
LELAENR

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16E, E35D, M36I, P39S, R41K, I62V, L63S, I64V, E65D  
>JCR099_0| codons 1-99
PQITLWQRPVVTVKIEGQLKEALLDTGADDTVLEDINLSGKWKPKMIGGIGGFIKVRQYD
QVSVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Sigaloff, KC Short communication: high rates of thymidine analogue mutations and dual-class resistance among HIV-infected Ugandan children failing first-line antiretroviral therapy. ARHR, 2013