<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, K70R, M184V D67G, K219H Y181C A98G, V108I V35T, K43E, K49R, V60I, I94L, K122E, I135M, S163SC, T165L, R172K, D177E, I178M, T200I, E204K, Q207E, R211K, E224K, V245K, D250E, A272P, Q278H, L282C, L283I, T286A, A288T E203R
>JCR047_0| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEEEGKISRIGPENPYNTPI
FAIKKKGSDRWRKLVDFRELNKRTQDFWEVQLGLPHPGGLKKKKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSCMLKILEPFKKQNPEMVI
CQYVDDLYVGSDLEIGQHRIKIRKLREHLLKWGFTTPDHKHQKKPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKHLCKCIRGAKTLTEVIPLTEEAE
LELAENREILK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16A, K20M, M36L, R41K, I64V, V75I  
>JCR047_0| codons 2-99
QITLWQRPVVTVKIAGQLMEALLDTGADDTVLEELNLPGKWKPKMIGGIGGFIKVRQYDQ
ILVEICGHKAIGTILVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Sigaloff, KC Short communication: high rates of thymidine analogue mutations and dual-class resistance among HIV-infected Ugandan children failing first-line antiretroviral therapy. ARHR, 2013