<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   Y181C   E6D, V35T, E44D, V60I, V111I, K122E, I135L, K166R, D177E, I178M, V179I, E203K, Q207D, H208Y, R211K, H221Y, V245Q, D250E, A272P, K277R, L282C, E297A  
>JCR011_0| codons 1-298
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKDGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSVPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEMII
CQYVDDLYVGSDLEIGQHRTKIKELRDYLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCLRGTKALTEVIPLTAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36I, N37D, L63Q, I64V  
>JCR011_0| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYD
QIQVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Sigaloff, KC Short communication: high rates of thymidine analogue mutations and dual-class resistance among HIV-infected Ugandan children failing first-line antiretroviral therapy. ARHR, 2013