<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, M184V, L210W, T215Y   Y181C, G190A K101H E28A, V35T, E44D, K49R, V60I, K122E, I135T, T139R, T165I, D177E, T200I, Q207E, R211K, L228R, V245K, D250E, A272P, K275R, L282C, L283I, T286A, V292I, I293V G316E
>MBA093_0| codons 1-317
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALTEICTELEKDGKISRIGPENPYNTPI
FAIKKKDSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNERPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPEIVI
CQYVDDLYVASDLEIGQHRIKIEELREHLWKWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIRVKQLCKCIRGAKALTEIVPLTEEAE
LELAENREILKEPVHEV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36I, R41K, I64V  
>MBA093_0| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Sigaloff, KC Short communication: high rates of thymidine analogue mutations and dual-class resistance among HIV-infected Ugandan children failing first-line antiretroviral therapy. ARHR, 2013