<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, Q61N, L63S, I64M, H69K, I72T  
>ANG32| codons 23-99
LLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDNISMEICGKKATGTVLVGPTPV
NIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, L74I, M184V, T215F D67G, K219Q K101E, G190A   I31L, V35T, T39A, E40D, K49R, V60I, S68G, V90I, D121C, K122E, E138G, E169D, D177E, I178L, G196E, T200A, E203D, E204K, Q207D, R211K, F214L, V245T, E248D, K249R, D250K P4N
>ANG32| codons 1-257
PISNIETVPVKLKPGMDGPKVKQWPLTEEKLKALTEICADMEKEGKISRIGPENPYNTPI
FAIKKKGGTRWRKIVDFRELNKRTQDFWEIQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
CEDFRKYTAFTIPSINNGTPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPELVI
YQYVDDLYVASDLEIEQHRAKIDKLRDHLLKWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPITLPDRKSWTVNDI

References
Author Title Citation
Afonso, JM HIV-1 genetic diversity and transmitted drug resistance mutations among patients from the North, Central and South regions of Angola. PLoS ONE, 2012