<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, L63S, I64L, C67*, H69K, V82I, L89M  
>ANG20| codons 23-99
LLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQISLEI*GKKAIGTVLVGPTPI
NIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, E40D, K122E, D123G, S162A, K173G, Q174K, D177E, T200A, Q207E, R211S, V245Q, D250E, S251N  
>ANG20| codons 1-257
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRGKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKENWTVNDI

References
Author Title Citation
Afonso, JM HIV-1 genetic diversity and transmitted drug resistance mutations among patients from the North, Central and South regions of Angola. PLoS ONE, 2012