<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
C08-6000C177 C08-6000C177 Japan 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, E35D, M36I, N37D, R41K, K43R, H69K, L89M  
>C08-6000C177| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDIDLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4H, E6D, K11S, V35T, T39N, V60I, K122E, D123DN, I142V, I159IV, K166R, K173R, Q174K, D177E, I178M, T200I, Q207A, R211S, V245E  
>C08-6000C177| codons 1-254
PISHIDTVPVSLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAVFQSSMTRILEPFRRKNPEMVI
YQYMDDLYVGSDLEIGQHRIKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTV

References
Author Title Citation
Hattori, J Trends in transmitted drug-resistant HIV-1 and demographic characteristics of newly diagnosed patients: nationwide surveillance from 2003 to 2008 in Japan. Antiviral Res, 2010