<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
D08-2031032 D08-2031032 Japan 2008 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I L10I, I13A, K14N, K20I, E34A, E35D, M36I, N37S, R41I, R57K, L63AT, H69K, L89M, F99L  
>D08-2031032| codons 1-99
PQITLWQRPIITANIGGQLIEALLDTGADDTVLADISLPGIWKPKMIGGIGGFIKVKQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNL

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K32R, V35T, K49R, V60I, I135V, S162A, K173I, Q174N, D177E, T200A, E204D, Q207G, R211K  
>D08-2031032| codons 1-240
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRINNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEDLRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Hattori, J Trends in transmitted drug-resistant HIV-1 and demographic characteristics of newly diagnosed patients: nationwide surveillance from 2003 to 2008 in Japan. Antiviral Res, 2010