<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F08-20081215 F08-20081215 Japan 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12S, K14R, I15V, L19I, N37S, R41K, I62V, L63T, C67D, H69R, L89M, I93L  
>F08-20081215| codons 1-99
PQITLWQRPIVSIRVGGQIKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
QVTIEIDGRKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35K, T39D, S48T, V60I, D121Y, K122E, S162C, K166R, K173A, D177E, T200A, Q207E, R211T  
>F08-20081215| codons 1-240
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICDEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTRILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLTWGFTTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Hattori, J Trends in transmitted drug-resistant HIV-1 and demographic characteristics of newly diagnosed patients: nationwide surveillance from 2003 to 2008 in Japan. Antiviral Res, 2010