<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
D06-2031012 D06-2031012 Japan 2006 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I I13A, G16GE, K20I, E35A, M36I, N37NS, R41K, R57K, L63X, H69K, K70KR, L89I  
>D06-2031012| codons 1-99
PQITLWQRPLITAKIEGQLIEALLDTGADDTVLEAISLPGKWKPKMIGGIGGFIKVKQYD
QIXIEICGKRAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, K32R, V35T, K49R, V60I, I135V, S162A, K173IT, Q174KN, D177E, T200A, E204D, Q207E, R211K  
>D06-2031012| codons 1-240
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIRALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTNNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEDLREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Hattori, J Trends in transmitted drug-resistant HIV-1 and demographic characteristics of newly diagnosed patients: nationwide surveillance from 2003 to 2008 in Japan. Antiviral Res, 2010