<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_240 TH_240 Thailand 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 EFV+ DDI+ D4T NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K101E, K103N   K20R, V35T, T39K, K43E, K104R, K122E, D123S, K173I, Q174K, D177E, Q207A, L210M, R211S, V245E  
>TH_240| codons 20-256
RVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLEKNRSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNET
PGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVIYQYMDDLYVGSDLEIGQHR
TKIEELRAHLMSWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVND

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005