<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_234 TH_234 Thailand 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M A62V, V75I, F77L, F116Y, K219E     V35T, T39E, K43E, S68G, K122E, D123S, R172K, K173I, Q174E, D177E, I178M, T200I, Q207N, R211S, K238R, V245E F130I, N136T, T165D
>TH_234| codons 18-254
GPKVKQWPLTEEKIKALTEICEEMEEEGKISKIGPENPYNTPVFVIKKKDGTKWRKLIDL
RELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFYSVPLDESFRKYTAITIPSITN
ETPGIRYQYNVLPMGWKGSPAIFQSSMDKILEPFKIENPEMVIYQYMDDLYVGSDLEIGQ
HRIKIEELRNHLLSWGFTTPDEKHQKEPPFLWMGYELHPDRWTVQPIELPEKDSWTV

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005