<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_228 TH_228 Thailand 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215Y K219E     V35T, D121H, K122E, I142L, I178M, T200V  
>TH_228| codons 25-258
PLTEEKIKALTEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRT
QDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSINNETPGLRY
QYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVIYQYMDDLYVGSDLEIGQHRVKIEE
LRQHLWRWGFYTPDEKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005