<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
D08-2031034 D08-2031034 Japan 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F T12P, I13V, M36I, N37ND, R41RK, L63P, C67S, H69K, K70R, L89M, I93L  
>D08-2031034| codons 1-99
PQITLWQRPLVPVKIGGQLKEALLDTGADDTVFEEIDLPGKWKPKMIGGIGGFIKVRQYD
QIPIEISGKRAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179E E6D, K11T, V35I, T39K, K43E, S68G, K122E, D123S, K173IR, Q174K, D177E, T200AEV, I202IV, Q207A, R211I  
>D08-2031034| codons 1-239
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALIEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRKNPEIEI
YQYMDDLYVGSDLEIGQHRVKVEELRAHLLIWGFTTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Hattori, J Trends in transmitted drug-resistant HIV-1 and demographic characteristics of newly diagnosed patients: nationwide surveillance from 2003 to 2008 in Japan. Antiviral Res, 2010