<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_223 TH_223 Thailand 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ IDV+ D4T+ DDI+ AZT NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39E, K43E, K122E, D123S, K173I, Q174R, D177E, V179I, I202V, Q207A, R211S, K238R, V245E P59T, L92I, I257N, Q258R
>TH_223| codons 31-258
IKALTEICEEMEEEGKISKIGPENPYNTTVFAIKKKDSTKWRKLVDFRELNKRTQDFWEV
QIGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLP
QGWKGSPAIFQSSMTKILEPFRIRNPEIIIYQYMDDLYVGSDLEIGQHRTKVEELRAHLL
SWGFTTPDKKHQKEPPFLWMGYELHPDRWTVQPIELPEKDSWTVNDNR

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, E35D, M36I, R41K, H69K, L89M  
>TH_223| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005