<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_203 TH_203 Thailand 2001 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ NVP+ 3TC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V G190A   M16V, V35I, K122E, D123S, I142V, K173I, Q174K, D177E, I178V, T200I, E203D, Q207A, R211S, K238S, V245E G15F, D17A
>TH_203| codons 15-256
FVAGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPVFVIKKKDSTKWRKL
VDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPS
INNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEVVIYQYVDDLYVASDLE
IGQHRIKIDELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDSWTVQPIELPEKDSWTV
ND

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005