<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_193 TH_193 Thailand 2001 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, T39K, K43E, V106I, K122E, D123N, K173I, Q174K, D177E, I178L, Q207A, R211S, K238R, V245E Q23T, W24V, P25A, H235L
>TH_193| codons 23-253
TVALTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNK
RTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGI
RYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPELVIYQYVDDLYVGSDLEIGQHRTKI
EELRAHLLSWGFTTPDKKHQKEPPFLWMGYELLPDRWTVQPIELPEKDSWT

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005