<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_161 TH_161 Thailand 2001 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ RTV+ SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, H69K, L89M  
>TH_161| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, K43E, K122E, D123S, K173T, Q174K, D177E, I178M, T200I, Q207A, K238R, V245E V254A
>TH_161| codons 19-254
PKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFR
ELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNE
TPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEMVIYQYMDDLYVGSDLEIGQH
RIKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDRWTVQPIELPEKDSWTA

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005