<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_149 TH_149 Thailand 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ NFV+ DDI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       V35L, T39S, E44D, K64H, V118I, D123E, I178M, T200A, R211K, V245E  
>TH_149| codons 22-256
KQWPLTEEKIKALLEICSELEKDGKISKIGPENPYNTPVFAIHKKNSTKWRKLVDFRELN
KRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSINNETPG
IRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVIYQYMDDLYVGSDLEIGQHRAK
IEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVND

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82S   L10I, L19V, L33M, N37H, R41K, K55R, I62V, L63P, C67L, H69Q, A71T, I72T  
>TH_149| codons 1-99
PQITLWQRPIVTIKIGGQVKEALLDTGADDTVMEEMHLPGKWKPKLIGGIGGFVRVRQYD
QVPIEILGQKTTGTVLVGPTPSNIIGRNLLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005