<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_146 TH_146 Thailand 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M V75I, F77L, F116Y, K219E   Y188YD E28V, V35T, T39A, S68G, I135V, S162C, K173I, Q174K, V245R E29R
>TH_146| codons 24-254
WPLTVRKIKALTEICAEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLIDLRELNKR
TQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFYSVPLDKDFRKYTAFTIPSVNNETPGIR
YQYNVLPMGWKGSPAIFQCSMTKILEPFRIKNPDIVIYQYMDDLDVGSDLEIGQHRTKIE
ELRQHLLRWGFTTPDEKHQKEPPFLWMGYELHPDKWTVQPIRLPEKDSWTV

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005