<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_145 TH_145 Thailand 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 EFV+ AZT+ DDI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219E K103N K238T K122E, D123N, I135T, R211S, F214L  
>TH_145| codons 22-249
KQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELN
KRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSTNNETPG
IRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTK
IEELRQHLLSWGLTTPDEKHQKEPPFLWMGYELHPDTWTVQPIVLPEK

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005