<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
C05-2069062 C05-2069062 Japan 2005 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16E, K20R, E35D, M36I, N37D, R41K, K43R, D60E, L63S, H69K, L89M, I93L  
>C05-2069062| codons 1-94
PQITLWQRPVVTVKIEGQLREALLDTGADDTVLEDIDLPGKWRPKMIGGIGGFIKVRQYE
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQLG

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39K, K43E, A98S, K122E, D123S, I135T, K173M, Q174K, D177E, Q207A, R211S, K238R, V245E  
>C05-2069062| codons 38-251
CKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRMKNPEIVIYQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTP
DKKHQKEPPFLWMGYELHPDRWTVQPIELPEKDS

References
Author Title Citation
Hattori, J Trends in transmitted drug-resistant HIV-1 and demographic characteristics of newly diagnosed patients: nationwide surveillance from 2003 to 2008 in Japan. Antiviral Res, 2010