<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1128 CA2539 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 47
2 DDI+ AZT 49
3 DDC+ AZT 5
4 RTV+ DDI+ AZT 22
5 RTV+ AZT+ 3TC 10
6 IDV+ AZT+ 3TC 15
7 IDV+ D4T+ 3TC 23
8 SQV+ IDV+ D4T+ 3TC 55

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10I, L63P, I64V, A71T  
>CA2539| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QIPVEICGHKTIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210W, T215Y K219Q     E6D, T39A, E44D, K122E, I202V, R211K  
>CA2538| codons 1-256
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLWKWGFYTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVND

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005