<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1127 CA2537 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 157
2 DDI 4
3 AZT+DDC 52
4 3TC+AZT 56
5 3TC+D4T+SQV 22
6 3TC+D4T+IDV 26
7 3TC+D4T+RTV+SQV 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A   L10I, M36I, N37D, R41X, L63P, I64L, A71V, I93L  
>CA2537| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEIDLPGXWKPKMIVGIGGFTKVRQYD
QIPLEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q     K20R, T69N, K102R, K122P, I135V, D177E, V179I, G196E, F214X, V245T  
>CA2536| codons 1-261
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIII
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGXFTPDQKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLV

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005