<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 RTI|RTV NA
2 ABC+DDI+LPV 52
3 3TC+AZT+LPV 213

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   L10IV, I15IV, G16GE, K20R, E35D, M36I, R41K, Q61N, L63C, H69K, T74A, L89M  
>5| codons 4-99
TLWQRPVVTIKVEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVRQYDNIC
IEICGKKAIGAVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, M184V, L210W, T215Y   G190A K101H T39E, E44ED, A98S, V118VI, K122E, D123S, I135M, T165TI, K173A, Q174K, D177G, G196E, T200A, E203EK, Q207D, R211RK, V245L P226PQ, V241D
>5| codons 38-247
CEEMEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLHKKKSVTVLDVGDAYFSIPLDESFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSP
AIFQSSMIKILEPFRAKNPGIVIYQYVDDLYVASDLEIEQHRAKIKELRDHLWKWGFYTP
DKKHQKEPQFLWMGYELHPDKWTDQPILLP

References
Author Title Citation
Grossman, Z Comparable long-term efficacy of lopinavir/ritonavir and similar drug-resistance profiles in different HIV-1 subtypes. PLoS ONE, 2014