<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
5 5 Israel 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 RTI|RTV NA
2 ABC+DDI+LPV 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24L*IR, N88ND L10V, I15V, K20R, E35D, M36I, R41K, Q61N, L63C, H69K, T74A, L89M  
>5| codons 4-99
TLWQRPVVTIKVGGQLREALRDTGADDTVLEDINLPGKWKPKLIGGIGGFVKVRQYDNIC
IEICGKKAIGAVLVGPTPANIIGRDMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, L210W, T215Y   G190A K101H T39E, A98S, K122E, D123S, K173A, Q174K, D177G, T200A, Q207D, V245Q  
>5| codons 38-247
CEEMEKEGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLHKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRAKNPGIVIYQYMDDLYVASDLEIGQHRAKIEELRDHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Grossman, Z Comparable long-term efficacy of lopinavir/ritonavir and similar drug-resistance profiles in different HIV-1 subtypes. PLoS ONE, 2014