<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 RTI|RTV NA
2 ABC+DDI+LPV 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24L*IR, N88ND L10V, I15V, K20R, E35D, M36I, R41K, Q61N, L63C, H69K, T74A, L89M  
>5| codons 4-99
TLWQRPVVTIKVGGQLREALRDTGADDTVLEDINLPGKWKPKLIGGIGGFVKVRQYDNIC
IEICGKKAIGAVLVGPTPANIIGRDMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, L210W, T215Y   G190A K101H T39E, A98S, K122E, D123S, K173A, Q174K, D177G, T200A, Q207D, V245Q  
>5| codons 38-247
CEEMEKEGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLHKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRAKNPGIVIYQYMDDLYVASDLEIGQHRAKIEELRDHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Grossman, Z Comparable long-term efficacy of lopinavir/ritonavir and similar drug-resistance profiles in different HIV-1 subtypes. PLoS ONE, 2014