<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 RTI|RTV|SQV NA
2 3TC+AZT+LPV 52
3 3TC+AZT+DDI+LPV 50

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I47V, G48V, I54A, V82C, L90M L33F, G73S L10I, E34Q, N37D, I62V, L63P, A71I, I72R, V77I, I93L  
>21| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVFQEMDLPGRWKPKMVVGIGGFAKVRQYDQVP
IEICGHKIRSTVLIGPTPCNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_VG, V75T A62V, D67E, T215I   A98G K122E, T200TA  
>21| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKESSKWRKLTDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFITP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Grossman, Z Comparable long-term efficacy of lopinavir/ritonavir and similar drug-resistance profiles in different HIV-1 subtypes. PLoS ONE, 2014