<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 RTI|RTV NA
2 D4T+DDI+LPV 52
3 3TC+AZT+LPV 63

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A, L90M   L10V, K14KQ, I15V, L19V, K20R, M36I, N37D, R41K, Q61E, L63P, H69K, A71V, I72IT, L89M, I93L  
>52| codons 4-99
TLWQRPVVTIQVGGQVREALLDTGADDTVLEEIDLPGKWKPKIIGGIGGFVKVRQYDEIP
IEICGKKVTGTVVVGPTPANIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, D67N, T69D, K70R, Q151M, M184MV K219Q     T39D, S68SG, A98S, K102Q, V118VI, K122E, D123S, I135T, S162A, K173T, Q174K, N175NK, D177E, T200A, F214L, L228H  
>52| codons 38-244
CDEMEKEGKISKIGPENPYNTPVFAIKRKNGDRWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKQKKSVTVLDVGDAYFSIPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQASMTKILEPFRTKKPEIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGLTTP
DQKHQKEPPFHWMGYELHPDKWTVQPI

References
Author Title Citation
Grossman, Z Comparable long-term efficacy of lopinavir/ritonavir and similar drug-resistance profiles in different HIV-1 subtypes. PLoS ONE, 2014