<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+LPV 121

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, L19I, K20R, E35D, N37E, R57K, L63P, A71T, V77I, I93L  
>492| codons 4-99
TLWQRPLVTIRIGGQIREALLDTGADDTVLEDMELPGRWKPKMIGGIGGFIKVKQYDQIP
IEICGHKTIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K103R, K122P, I135T, I142L, T165I, D177DH, T200I, R211K, F214L I37L, D186DN
>492| codons 37-247
LCTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKRKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSTNNETPGLRYQYNVLPQGWKGS
PAIFQSSMIKILEPFRKQNPHIVIYQYMDNLYVGSDLEIGQHRIKIEELRQHLLKWGLTT
PDKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Grossman, Z Comparable long-term efficacy of lopinavir/ritonavir and similar drug-resistance profiles in different HIV-1 subtypes. PLoS ONE, 2014