<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 RTI|SQV NA
2 LPV 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L10F, L23I T12S, I15V, L19I, K20R, E35D, M36I, R41K, L63P, H69K, L89M, I93L  
>50| codons 4-99
TLWQRPFVSIKVGGQIREAILDTGADDTVLEDINLPGKWKPKLIGGIGGFVKVRQYDQIP
IEICGKKAIGTVLVGPTPANIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N A98G T39E, S48T, K122E, D123G, I135T, K173A, D177E, G196K, T200A, R211K, V245Q Q182QH, Q207NY
>50| codons 38-247
CEEMEKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTVLDVGDAYFSVPLDEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRAQNPEIVIYHYMDDLYVGSDLEIKQHRAKIEELRYHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Grossman, Z Comparable long-term efficacy of lopinavir/ritonavir and similar drug-resistance profiles in different HIV-1 subtypes. PLoS ONE, 2014