<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NFV|RTI NA
2 D4T+DDI+LPV 83
3 3TC+LPV+SQV+TDF 111

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84V L10F, L24I, L33F, N88D I13V, G16A, N37S, K55KR, R57RK, Q61E, L63P, A71V, V77I T91TCS
>59| codons 4-99
TLWQRPFVTVKIAGQLKEALIDTGADDTVFEEMSLPGRWKPKIIGGIGGFVRVKQYDEIP
IEICGHKVIGTVLIGPTPANVIGRDLLSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, V75M, M184V, L210W, T215Y K219KDEN K101E, G190C A98G E40F, K43E, K122E, I135V, V179G, Q197L, H208Y, R211K, L228LH, V245M  
>59| codons 38-247
CTFLEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKIMDFRELNKRTQDFWEVQLGIPHP
GGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIGIYQYVDDLYVCSDLEIGLHRTKIEELRQYLWKWGFYTP
DNKHQKEPPFHWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Grossman, Z Comparable long-term efficacy of lopinavir/ritonavir and similar drug-resistance profiles in different HIV-1 subtypes. PLoS ONE, 2014