<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NFV|RTI NA
2 D4T+DDI+LPV 83

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN, M46I, I54V, V82A L33F, N88D P9X, I13V, N37S, R57K, Q61E, L63P, A71V, V77I T91TCS
>59| codons 4-99
TLWQRXLVTVKIGGQLKEALLDTGADNTVFEEMSLPGRWKPKIIGGIGGFVKVKQYDEIP
IEICGHKVIGTVLIGPTPANIIGRDLLSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y V75M K101E, G190C A98G E40F, K43E, V118VI, K122E, I135V, V179G, Q197L, H208Y, R211K, V245M S117SL
>59| codons 38-247
CTFLEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHP
GGLEKKKSVTVLDVGDAYFLIPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIGIYQYMDDLYVCSDLEIGLHRTKIEELRQYLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Grossman, Z Comparable long-term efficacy of lopinavir/ritonavir and similar drug-resistance profiles in different HIV-1 subtypes. PLoS ONE, 2014