<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 RTI|SQV NA
2 3TC+DDI+LPV 106
3 3TC+D4T+DDI+LPV 38

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A, I84V Q58E L10I, I15V, L19I, K20R, M36I, N37D, D60E, L63P, H69R, P79A, L89M  
>33| codons 4-99
TLWQRPIVTIKVGGQIREALLDTGADDTVLEEIDLPGRWKPKIIGGIGGFVKVREYEQIP
IEICGRKAIGTVVVGATPANVIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, V75M, M184I, L210W, T215Y K219R K101KE, Y181YC, G190GA V108VI E44D, V60I, V118I, K122E, K126KE, Q174K, N175Y, E194ED, G196E, T200R, E203V, Q207E, R211A, D218E, Q242L I37L
>33| codons 37-247
LCTELEKDGKISKIGPENPYNTPIFAIKKKNSDKWRKLMDFRELNKRTQDFWEVQLGIPH
PAGLEKKKSVTILDVGDAYFSIPLDEDFREYTAFTIPSINNETPGIRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRKKYPDIVICQYIDDLYVASDLDIEQHRRKIVELREHLWAWGFYT
PERKHQKEPPFLWMGYELHPDKWTVLPIVLP

References
Author Title Citation
Grossman, Z Comparable long-term efficacy of lopinavir/ritonavir and similar drug-resistance profiles in different HIV-1 subtypes. PLoS ONE, 2014