<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MR041 MR041 Cameroon 2011 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA
2 NNRTI|NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20R, M36I, N37D, R41K, H69K, L89M  
>MR041| codons 1-99
PQITLWQRPLVTVRIGGQLREALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Billong, SC Population-based monitoring of emerging HIV-1 drug resistance on antiretroviral therapy and associated factors in a sentinel site in Cameroon: low levels of resistance but poor programmatic performance. PLoS ONE, 2013