<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1123 CA2529 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 35
2 D4T+DDC+RTV+SQV 19

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82AT, L90M   L10LI, M36IV, R41K, K45R, I62V, L63P, A71T  
>CA2529| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEVNLPGKWKPRMIGGIGGFIKVRQYD
QVPIEICGHKTIGTVLVGPTPTNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V, T215F K219Q     V35M, D121Y, K122E, I135L, L168X, E169D, D177E, I202V, R211K, K277R, T286A, P294S  
>CA2528| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKIXDPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVISLTEEAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005