<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LI, I13V, K14KR, K20I, E35K, M36I, N37D, R41K, I64IM, H69K, L89M  
>MR101| codons 1-99
PQITLWQRPIVTVRIGGQLIEALLDTGADDTVLEKIDLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K102Q, K122E, D123NS, S162A, F171Y, K173AITV, Q174E, D177E, I178M, T200A, E204K, Q207E, R211K, F214L, V245Q, E248DN, A272P, K277R, T286A, E291D, V292I, I293V, P294PT, S322G, A327V G141GR
>MR101| codons 1-340
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPRIRYQYNVLPQGWKGSPAIFQASMTKILEPYRVENPEMVI
YQYMDDLYVGSDLEIGQHRAKIEKLREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPGKDLIVEIQKQGQGQWTYQ

References
Author Title Citation
Billong, SC Population-based monitoring of emerging HIV-1 drug resistance on antiretroviral therapy and associated factors in a sentinel site in Cameroon: low levels of resistance but poor programmatic performance. PLoS ONE, 2013