<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SN.MS821 SN.MS821 Senegal 2004 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, M36T, R41K, L63S, H69K, L89M, I93L  
>SN.MS821| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEETNLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, K122E, D123G, K173A, D177E, G196K, T200A, I202V, Q207E, R211K, V245Q, D250E, L260I, A272P, K277R, T286A, E291D, V292I, I293V, D324E, Q334H, G335D, R356K, G359T, V365I, K390R, A400T, E432D, V435I  
>SN.MS821| codons 1-444
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIKQHRAKVEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKIVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDIKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIIGAETFYVDG

References
Author Title Citation
Leye, N High frequency of HIV-1 infections with multiple HIV-1 strains in men having sex with men (MSM) in Senegal. Infect Genet Evol, 2013