<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TA, I13V, K14R, G16E, K20I, E35N, M36I, R41K, H69K, V77I, L89M  
>9-1519-22| codons 1-99
PQITLWQRPLVAVRIEGQLIEALLDTGADDTVLENINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21I, V35T, T39M, V60I, D123N, Q174DE, D177E, I178M, T200A, Q207E, V245Q, E248N, K277R, Q278E, L283I, V292I, I293V, E297A, Q334H, F346H, M357I, R358K, G359S, K366R, T377L, K390R, Q394H, A400T, K431T, V435I  
>9-1519-22| codons 1-438
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICMEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKENPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYAGIKVRELCKLIRGTKALTEIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHGQWTYQIYQEPHKNLKTGKYARIKSA
HTNDVRQLTEAVQKIALESIVIWGKTPKFRLPIHKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIIGAE

References
Author Title Citation
Somda, A Surveillance of transmitted drug-resistant HIV among young pregnant women in Ouagadougou, Burkina Faso. Clin Infect Dis, 2012