<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35S, T39M, V60I, V118I, D123DN, I135V, T139K, S162A, T165I, K173T, Q174K, D177E, T200A, Q207E, F214L, P243S, V245Q, E248D, D250E, T286A, E291D, V292I, I293V, P294T, S322T, I326V, G335D, R356K, M357R, G359T, T369AV, A371V, V372VA, I375V, A376T, T377M, T386A, K390R, E399D, A400T, T403A  
>9-3050-18| codons 1-431
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALSEICMEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKNFRKYTAFTIPSVNNEKPGIRYQYNVLPQGWKGSPAIFQASMIKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQSIQLPDKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRRTA
HTNDVKQLVEVAQKVTMESIVIWGKAPKFRLPIQKETWDTWWAEYWQATWIPEWEFVNTP
PLVKLWYQLEK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F I13V, K14R, K20I, E35E_N, M36I, P39Q, R41K, L63GISV, C67Y, H69K, L89M  
>9-3050-18| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVFEEINLQGKWKPKMIGGIGGFIKVRQYD
QIVIEIYGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Somda, A Surveillance of transmitted drug-resistant HIV among young pregnant women in Ouagadougou, Burkina Faso. Clin Infect Dis, 2012