<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ10-199 HIV-1 Mozambique 2009 HIV1 C Dried Blood Spot None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, L19I, M36I, R41K, L63C, H69K, I93L  
>HIV-1| codons 1-99
PQITLWQRPLVAIKIGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QICIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39D, Q85*, K122E, D123N, S162C, E169K, K173A, P176PS, D177E, I178L, T200TA, Q207E, V245Q, A272S, K277R, T286A, E291D, V292I, I293V, E312K, P321PS, Q334H, G335D  
>HIV-1| codons 1-338
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRT*DFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILKPFRAQNSELVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKKPVHGVYYDSSKDLIAEIQKQGHDQWT

References
Author Title Citation
Bila, DC Evolution of primary HIV drug resistance in a subtype C dominated epidemic in Mozambique. PLoS ONE, 2013