<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11VI I15V, L19V, M36I, R41K, K43R, L63S, H69K, L89M, I93L  
>HIV-1| codons 1-99
PQITLWQRPLITIKVGGQVKEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, E36EA, T39E, S48T, K122E, D123G, I142IV, K173A, D177E, I178L, V189VI, T200AV, Q207D, R211K, V245E, E248DN, D250E, A272PS, K275KR, K277R, E291D, V292I, I293V, E300EK, P313T, Q334H, G335D E302EK
>HIV-1| codons 1-338
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPELVI
YQYMDDLYIGSDLEIGQHRVKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPNKESWTVNDIQKLVGKLNWASQIYSGIRVRQLCKLLRGTKALTDIVPLTEEAK
LKLAENREILKETVHGVYYDPSKDLIAEIQKQGHDQWT

References
Author Title Citation
Bila, DC Evolution of primary HIV drug resistance in a subtype C dominated epidemic in Mozambique. PLoS ONE, 2013