<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ10-269 HIV-1 Mozambique 2009 HIV1 C Dried Blood Spot None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15IV, Q18QK, L19IT, M36T, N37D, L63P, H69K, L89M, I93L  
>HIV-1| codons 1-99
PQITLWQRPLVTIKVGGKTKEALLDTGADDTVLEETDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D25E, V31I, I72V, F100Y, L101I, T112V, T124A, T125A, K136Q, S195C, V201I, L234I, A265V, D278A K188N, S283G
>HIV-1| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYYILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRNGGIGGYCAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGADCVAGRQDED

References
Author Title Citation
Bila, DC Evolution of primary HIV drug resistance in a subtype C dominated epidemic in Mozambique. PLoS ONE, 2013