<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L5F, L10I, I13V, G16E, K20R, E35D, M36I, L63T, C67S, H69K, L89M  
>09MYKL026| codons 1-99
PQITFWQRPIVTVKIEGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QITIEISGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D K20R, K122E, D123N, I135R, S162C, K173AITV, Q174K, D177E, Q207D, K238R, V245E E53EA, I180IT
>09MYKL026| codons 1-251
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPANPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRVKNPEIDT
YQYMDDLYVGSDLEIGQHRTKIEELRDHLLRWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDS

References
Author Title Citation
Ong, LY Molecular diversity of HIV-1 and surveillance of transmitted drug resistance variants among treatment naive patients, 5 years after active introduction of HAART in Kuala Lumpur, Malaysia. J Med Virol, 2013