<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LVLBV06_12 LVLBV06_12 Gabon 2000 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, I15V, K20I, E35D, M36I, R41K, C67E, H69K, V82I, L89M  
>LVLBV06_12| codons 1-99
PQITLWQRPLVTAKVGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEIEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I5V, V35T, K49R, K102Q, K122E, D123S, K173T, D177E, T200A, Q207E, V245Q, E248D, D250E, S251N, A272P, E291D, V292I, I293V, P294A, E297A, I329V, Q334L, G335D, R356K, M357R, G359T, A371V, V372T, T377M, K390R, A400T, E404D, E413Q K374I, P387L
>LVLBV06_12| codons 1-414
PISPVETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKENWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVALTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGLDQWTYQIYQEPFKNLKTGKYAKRRTA
HTNDVKQLTEVTQIIAMESIVIWGKTLKFRLPIQKETWETWWTDYWQATWIPQW

References
Author Title Citation
Vergne, L Resistance to antiretroviral treatment in Gabon: need for implementation of guidelines on antiretroviral therapy use and HIV-1 drug resistance monitoring in developing countries. JAIDS, 2002